PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA17097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 292aa    MW: 32180.6 Da    PI: 8.8163
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA17097genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.31.4e-373999262
                     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                               +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg ++n+k+s
  Tp57577_TGAC_v2_mRNA17097 39 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGYKRNNKRS 99
                               57899************************************************99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-253991IPR003851Zinc finger, Dof-type
PfamPF027012.3E-324197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6494397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MLANCEKMVS IPPTTNQWPQ NQIDDGKVIM EKQGQELMQQ QALKCPRCDS SNTKFCYYNN  60
YSLSQPRHFC KACKRYWTRG GTLRNVPVGG GYKRNNKRSN NSTNPLIKRP ISTIDSTTTT  120
ATTSAPSSTL NHISPMFYGL SRLSSSSEYD FHPQMNSSGL GGFSSSGFGH NGFTSNNNNH  180
VSRYDSSIFS FASSSSTSMS VMPSTLLQYN FNNDGLKYSQ DASSNCTFQG LEFASLEHMQ  240
RAISNIGNGS EKMKKVEGQN QIEHVNGLYD PSSFFWNDQG ANIGSSVTSL I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0878482e-75AB087848.1 Pisum sativum PsDof3 mRNA for DNA binding with one finger 3 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593614.12e-82Dof-type zinc finger DNA-binding family protein
TrEMBLG7ISD22e-82G7ISD2_MEDTR; Dof-type zinc finger DNA-binding family protein
TrEMBLQ76KV12e-82Q76KV1_PEA; DNA binding with one finger 3 protein
STRINGGLYMA15G08250.12e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.12e-31Dof family protein